Anti-ARID1A Antibody Picoband™

ARID1A antibody

Boster Bio Anti-ARID1A Antibody Picoband™ catalog # PB9685. Tested in WB applications. This antibody reacts with Human.

Product Info Summary

SKU: PB9685
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: WB

Product Name

Anti-ARID1A Antibody Picoband™

View all ARID1A Antibodies

SKU/Catalog Number

PB9685

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-ARID1A Antibody Picoband™ catalog # PB9685. Tested in WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-ARID1A Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9685)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human ARID1A, identical to the related mouse sequence.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9685 is reactive to ARID1A in Human

Applications

PB9685 is guaranteed for WB Boster Guarantee

Observed Molecular Weight

242 kDa

Calculated molecular weight

242.045kDa

Background of ARID1A

AT-rich interactive domain-containing protein 1A, also known as p270, is a protein that in humans is encoded by the ARID1A gene. This gene encodes a member of the SWI/SNF families, whose members have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. ARID1A is mapped to 1p36.11. It possesses at least two conserved domains that could be important for its function. First, it has a DNA-binding domain that can specifically bind an AT-rich DNA sequence known to be recognized by a SNF/SWI complex at the beta-globin locus. Second, the C-terminus of the protein can stimulate glucocorticoid receptor-dependent transcriptional activation.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human

Validation Images & Assay Conditions

Gene/Protein Information For ARID1A (Source: Uniprot.org, NCBI)

Gene Name

ARID1A

Full Name

AT-rich interactive domain-containing protein 1A

Weight

242.045kDa

Alternative Names

ARID domain-containing protein 1A; AT rich interactive domain 1A (SWI- like); AT rich interactive domain 1A (SWI-like); AT-rich interactive domain-containing protein 1A; B120SWI-like protein; BAF250a; BAF250SWI/SNF complex protein p270; BM029; brain protein 120; BRG1-associated factor 250; BRG1-associated factor 250a; C10rf4; C1orf4SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatinsubfamily F member 1; chromatin remodeling factor p250; hELD; hOSA1; matrix associated, actin dependent regulator of chromatin; Osa homolog 1; OSA1 nuclear protein; OSA1; P270; SMARCF1; subfam ARID1A B120, BAF250, BAF250a, BM029, C1orf4, CSS2, ELD, MRD14, OSA1, P270, SMARCF1, hELD, hOSA1 AT-rich interaction domain 1A AT-rich interactive domain-containing protein 1A|ARID domain-containing protein 1A|AT rich interactive domain 1A (SWI-like)|BRG1-associated factor 250a|OSA1 nuclear protein|SWI-like protein|SWI/SNF complex protein p270|SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1|brain protein 120|chromatin remodeling factor p250|osa homolog 1

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on ARID1A, check out the ARID1A Infographic

ARID1A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ARID1A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for PB9685

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-ARID1A Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review Anti-ARID1A Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

15 Customer Q&As for Anti-ARID1A Antibody Picoband™

Question

I see that the anti-ARID1A antibody PB9685 works with WB, what is the protocol used to produce the result images on the product page?

G. Jones

Verified customer

Asked: 2020-04-07

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2020-04-07

Question

I am looking for to test anti-ARID1A antibody PB9685 on human leukemic t-cell for research purposes, then I may be interested in using anti-ARID1A antibody PB9685 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2020-01-20

Answer

The products we sell, including anti-ARID1A antibody PB9685, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2020-01-20

Question

Our team were satisfied with the WB result of your anti-ARID1A antibody. However we have been able to see positive staining in cervix carcinoma erythroleukemia nucleus using this antibody. Is that expected? Could you tell me where is ARID1A supposed to be expressed?

Verified Customer

Verified customer

Asked: 2019-08-06

Answer

According to literature, cervix carcinoma erythroleukemia does express ARID1A. Generally ARID1A expresses in nucleus. Regarding which tissues have ARID1A expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 11734557
Cervix carcinoma, Pubmed ID: 16964243, 17081983, 18220336, 18669648, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Colon carcinoma, Pubmed ID: 24129315
Embryonic kidney, Pubmed ID: 17525332
Gastric mucosa, Pubmed ID: 8804307
Leukemic T-cell, Pubmed ID: 19690332
Liver, Pubmed ID: 24275569

Boster Scientific Support

Answered: 2019-08-06

Question

Do you have a BSA free version of anti-ARID1A antibody PB9685 available?

Verified Customer

Verified customer

Asked: 2019-07-31

Answer

Thanks for your recent telephone inquiry. I can confirm that some lots of this anti-ARID1A antibody PB9685 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-07-31

Question

We are currently using anti-ARID1A antibody PB9685 for human tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human. Is it possible that the antibody can work on primate tissues as well?

Verified Customer

Verified customer

Asked: 2019-06-19

Answer

The anti-ARID1A antibody (PB9685) has not been tested for cross reactivity specifically with primate tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in primate you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-06-19

Question

We have been able to see staining in human cerebral cortex. Do you have any suggestions? Is anti-ARID1A antibody supposed to stain cerebral cortex positively?

Verified Customer

Verified customer

Asked: 2019-03-15

Answer

Based on literature cerebral cortex does express ARID1A. Based on Uniprot.org, ARID1A is expressed in cerebral cortex, brain, gastric mucosa, cervix carcinoma, embryonic kidney, leukemic t-cell, cervix carcinoma erythroleukemia, liver, colon carcinoma, among other tissues. Regarding which tissues have ARID1A expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 11734557
Cervix carcinoma, Pubmed ID: 16964243, 17081983, 18220336, 18669648, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Colon carcinoma, Pubmed ID: 24129315
Embryonic kidney, Pubmed ID: 17525332
Gastric mucosa, Pubmed ID: 8804307
Leukemic T-cell, Pubmed ID: 19690332
Liver, Pubmed ID: 24275569

Boster Scientific Support

Answered: 2019-03-15

Question

Please see the WB image, lot number and protocol we used for leukemic t-cell using anti-ARID1A antibody PB9685. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2018-12-31

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-12-31

Question

Is a blocking peptide available for product anti-ARID1A antibody (PB9685)?

Verified Customer

Verified customer

Asked: 2018-10-18

Answer

We do provide the blocking peptide for product anti-ARID1A antibody (PB9685). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2018-10-18

Question

Would PB9685 anti-ARID1A antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2018-10-01

Answer

As indicated on the product datasheet, PB9685 anti-ARID1A antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2018-10-01

Question

I am interested in using your anti-ARID1A antibody for coffin-siris syndrome 2 (css2) studies. Has this antibody been tested with western blotting on hepg2 whole cell lysate? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2018-08-27

Answer

Thanks for your inquiry. This PB9685 anti-ARID1A antibody is validated on sw620 whole cell lysate, hepg2 whole cell lysate. It is guaranteed to work for WB in human. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2018-08-27

Question

Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for leukemic t-cell using anti-ARID1A antibody PB9685. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2018-02-16

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-02-16

Question

I have a question about product PB9685, anti-ARID1A antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2017-07-07

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9685 anti-ARID1A antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2017-07-07

Question

I was wanting to use your anti-ARID1A antibody for WB for human leukemic t-cell on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human leukemic t-cell identification?

A. Moore

Verified customer

Asked: 2017-07-06

Answer

It shows on the product datasheet, PB9685 anti-ARID1A antibody has been tested for WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human leukemic t-cell in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2017-07-06

Question

Is this PB9685 anti-ARID1A antibody reactive to the isotypes of ARID1A?

B. Williams

Verified customer

Asked: 2016-11-15

Answer

The immunogen of PB9685 anti-ARID1A antibody is A synthetic peptide corresponding to a sequence in the middle region of human ARID1A (1021-1053aa KMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYR), identical to the related mouse sequence. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2016-11-15

Question

Will anti-ARID1A antibody PB9685 work for WB with leukemic t-cell?

Z. Brown

Verified customer

Asked: 2015-11-03

Answer

According to the expression profile of leukemic t-cell, ARID1A is highly expressed in leukemic t-cell. So, it is likely that anti-ARID1A antibody PB9685 will work for WB with leukemic t-cell.

Boster Scientific Support

Answered: 2015-11-03

Order DetailsPrice
PB9685

100μg

$370
PB9685-10ug

10μg sample (liquid)

$99
PB9685-Biotin

100 μg Biotin conjugated

$570
PB9685-Cy3

100 μg Cy3 conjugated

$570
PB9685-Dylight488

100 μg Dylight488 conjugated

$570
PB9685-Dylight550

100 μg Dylight550 conjugated

$570
PB9685-Dylight594

100 μg Dylight594 conjugated

$570
PB9685-FITC

100 μg FITC conjugated

$570
PB9685-HRP

100 μg HRP conjugated

$570
PB9685-APC

100 μg APC conjugated

$670
PB9685-PE

100 μg PE conjugated

$670
PB9685-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9685
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.